PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10022505
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 355aa    MW: 39517.9 Da    PI: 5.7464
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10022505genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF33.26.7e-11951951
                 HHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  9 rqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 r  ++skRr  ++ KA+E++   da+va + fs+ g+l  +ss
  Lus10022505  9 RASSLSKRRSNLIRKAQEICFFGDADVAFVAFSPCGRLTKFSS 51
                 6779************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.0058152IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-13876IPR002100Transcription factor, MADS-box
PfamPF003193.1E-9949IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.33953IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-51530IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-53051IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MHNSEGGGRA SSLSKRRSNL IRKAQEICFF GDADVAFVAF SPCGRLTKFS SKKRIEDILQ  60
KYVDLPAGQR YKIHHLELQI KKAQVDIEIL DANLRDYELH PEQQSDHSLP QLLWCEKNLN  120
RELQRVLHRK NYLTGSNCSS PYHGCPFMAR RDVVERGNLG SVSSPFSSYA GEELTRPNQS  180
MSYSQLIMKL DPWISPYSPK VRDTIIRDIL TGPSPDHNGT TSEHFEESSS RPVTQTCPFD  240
VLYNTSPPLE KNIPDCHLSH RPFIPTPMNV TSGDNSNTNF DVGNYGDGPN TKYSAAAPKN  300
PTPEDPPLLH GVSSEDEVGN GGFGSGTNQE FGSPDWDGFL LADNLNFDDL DIVF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77950.23e-09AGAMOUS-like 67